Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pard6b Peptide - N-terminal region

Pard6b Peptide - N-terminal region

Product Specifications

Product Name Alternative

AV025615, Par6b

UniProt

Q9JK83

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pard6b Rabbit Polyclonal Antibody (orb578646) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067384

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azelaic Acid
TRC-A808140-1G 1 g

Azelaic Acid

Sign In for Pricing
View Details
Tissue Total RNA, Smooth muscle
CR562600 5 µg

Tissue Total RNA, Smooth muscle

Sign In for Pricing
View Details
Reep6 (BC029741) Mouse Tagged ORF Clone
MG201510 10 µg

Reep6 (BC029741) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human RAB5C activation kit by CRISPRa
GA103992 1 Kit

Human RAB5C activation kit by CRISPRa

Sign In for Pricing
View Details
EPCAM Rabbit Monoclonal Antibody [Clone ID: R08-8D1]
TA421637 100 µL

EPCAM Rabbit Monoclonal Antibody [Clone ID: R08-8D1]

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6F6]
TA802661AM 100 µL

Cytokeratin 20 (KRT20) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6F6]

Sign In for Pricing
View Details