Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRAP Peptide - N-terminal region

MRAP Peptide - N-terminal region

Product Specifications

UniProt

Q8TCY5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRAP Rabbit Polyclonal Antibody (orb579613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Poly [ADP-ribose] polymerase 1 (PARP1), partial
CSB-EP017457HU1-01 20 µg

Recombinant Human Poly [ADP-ribose] polymerase 1 (PARP1), partial

Sign In for Pricing
View Details
Recombinant Human Poly [ADP-ribose] polymerase 1 (PARP1), partial
CSB-EP017457HU1-02 100 µg

Recombinant Human Poly [ADP-ribose] polymerase 1 (PARP1), partial

Sign In for Pricing
View Details
Recombinant Human Poly [ADP-ribose] polymerase 1 (PARP1), partial
CSB-EP017457HU1-03 1 mg

Recombinant Human Poly [ADP-ribose] polymerase 1 (PARP1), partial

Sign In for Pricing
View Details
GHRH Antibody, HRP Conjugated
MBS7133629-01 0.05 mg

GHRH Antibody, HRP Conjugated

Sign In for Pricing
View Details
GHRH Antibody, HRP Conjugated
MBS7133629-02 0.1 mg

GHRH Antibody, HRP Conjugated

Sign In for Pricing
View Details
GHRH Antibody, HRP Conjugated
MBS7133629-03 5x 0.1 mg

GHRH Antibody, HRP Conjugated

Sign In for Pricing
View Details