MRAP Peptide - N-terminal region
MRAP Peptide - N-terminal region
Product Specifications
UniProt
Q8TCY5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRAP Rabbit Polyclonal Antibody (orb579613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1076816 Inquire
Recombinant Caenorhabditis elegans Uncharacterized protein tag-51 (tag-51), partial
Sign In for Pricing
View Details 
P1951-10-AP 100 µL
PAG (Phosphoprotein Associated With Glycosphingolipid-Enriched Microdomains 1, Transmembrane Adapter Protein PAG, Csk-Binding Protein, Transmembrane Phosphoprotein Cbp, PAG1, CBP) (AP) discontinued
Sign In for Pricing
View Details