ZNF134 Peptide - middle region
ZNF134 Peptide - middle region
Product Specifications
UniProt
P52741
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF134 Rabbit Polyclonal Antibody (orb581058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TLVQHQRIHSGEKPYECSECGKAFSRKATLVQHQRIHTGERPYECSECGK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KBH4510 1x 96 Well
GENLISA™ Human Gamma-carboxyglutamic Acid Protein 1 (PRRG1) ELISA
Sign In for Pricing
View Details ![6,7-Dihydropyrazino[2,3-d]pyridazine-5,8-dione (Impurity)](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
OR1041857-01 25 mg
6,7-Dihydropyrazino[2,3-d]pyridazine-5,8-dione (Impurity)
Sign In for Pricing
View Details OR1041857-02 100 mg
6,7-Dihydropyrazino[2,3-d]pyridazine-5,8-dione (Impurity)
Sign In for Pricing
View Details OR1041857-03 250 mg
6,7-Dihydropyrazino[2,3-d]pyridazine-5,8-dione (Impurity)
Sign In for Pricing
View Details OR1041857-04 1 g
6,7-Dihydropyrazino[2,3-d]pyridazine-5,8-dione (Impurity)
Sign In for Pricing
View Details 
DL-HINT2-Mu-01 48 Tests
Mouse Histidine Triad Nucleotide Binding Protein 2 (HINT2) ELISA Kit
Sign In for Pricing
View Details