Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF134 Peptide - middle region

ZNF134 Peptide - middle region

Product Specifications

UniProt

P52741

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF134 Rabbit Polyclonal Antibody (orb581058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVQHQRIHSGEKPYECSECGKAFSRKATLVQHQRIHTGERPYECSECGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-OR2Z Antibody
MBS8322657-01 0.03 mL

Anti-OR2Z Antibody

Sign In for Pricing
View Details
Anti-OR2Z Antibody
MBS8322657-02 0.05 mL

Anti-OR2Z Antibody

Sign In for Pricing
View Details
Anti-OR2Z Antibody
MBS8322657-03 0.1 mL

Anti-OR2Z Antibody

Sign In for Pricing
View Details
Anti-OR2Z Antibody
MBS8322657-04 0.2 mL

Anti-OR2Z Antibody

Sign In for Pricing
View Details
Anti-OR2Z Antibody
MBS8322657-05 5x 0.2 mL

Anti-OR2Z Antibody

Sign In for Pricing
View Details
Human USP25 Protein Lysate 20ug
IHUUSP25PLLY20UG 20 µg

Human USP25 Protein Lysate 20ug

Sign In for Pricing
View Details