APH1B Peptide - N-terminal region
APH1B Peptide - N-terminal region
Product Specifications
Product Name Alternative
APH-1B, PRO1328, PSFL, TAAV688
UniProt
Q8WW43
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with APH1B Rabbit Polyclonal Antibody (orb325898) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112591
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15214208 1 Vial
Lentiviral mouse Tcta shRNA (UAS) - Lentiviral mouseTcta shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
orb3076400 100 µg
Kv1.2/KCNA2 Rabbit Polyclonal Antibody (Carrier-free)
Sign In for Pricing
View Details 