Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APH1B Peptide - N-terminal region

APH1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

APH-1B, PRO1328, PSFL, TAAV688

UniProt

Q8WW43

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APH1B Rabbit Polyclonal Antibody (orb325898) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112591

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP3R1 siRNA (Mouse)
MBS8234541-01 15 nmol

PPP3R1 siRNA (Mouse)

Sign In for Pricing
View Details
PPP3R1 siRNA (Mouse)
MBS8234541-02 30 nmol

PPP3R1 siRNA (Mouse)

Sign In for Pricing
View Details
PPP3R1 siRNA (Mouse)
MBS8234541-03 5x 30 nmol

PPP3R1 siRNA (Mouse)

Sign In for Pricing
View Details
Human CD69 Recombinant Protein
PROTQ07108-10ug 10 µg

Human CD69 Recombinant Protein

Sign In for Pricing
View Details
Anti-NAPRT Antibody Picoband®, Dylight550 Conjugate
A10553-1-Dylight550 100 µg

Anti-NAPRT Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
HLA-DR Antibody (YA6179, Rabbit)
HY-P86487-01 10 µL

HLA-DR Antibody (YA6179, Rabbit)

Sign In for Pricing
View Details