Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM68 Peptide - N-terminal region

TMEM68 Peptide - N-terminal region

Product Specifications

UniProt

Q96MH6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM68 Rabbit Polyclonal Antibody (orb327120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYLLWVFTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCDC5 Antibody - N-terminal region
ARP67480_P050-25UL 25 µL

DCDC5 Antibody - N-terminal region

Sign In for Pricing
View Details
Gpr88 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7091606 1.0 µg DNA

Gpr88 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Guinea pig Cell surface glycoprotein CD200 receptor 2 (CD200R1L) ELISA Kit
MBS7251628-01 48 Well

Guinea pig Cell surface glycoprotein CD200 receptor 2 (CD200R1L) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cell surface glycoprotein CD200 receptor 2 (CD200R1L) ELISA Kit
MBS7251628-02 96 Well

Guinea pig Cell surface glycoprotein CD200 receptor 2 (CD200R1L) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cell surface glycoprotein CD200 receptor 2 (CD200R1L) ELISA Kit
MBS7251628-03 5x 96 Well

Guinea pig Cell surface glycoprotein CD200 receptor 2 (CD200R1L) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cell surface glycoprotein CD200 receptor 2 (CD200R1L) ELISA Kit
MBS7251628-04 10x 96 Well

Guinea pig Cell surface glycoprotein CD200 receptor 2 (CD200R1L) ELISA Kit

Sign In for Pricing
View Details