Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM68 Peptide - N-terminal region

TMEM68 Peptide - N-terminal region

Product Specifications

UniProt

Q96MH6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM68 Rabbit Polyclonal Antibody (orb327120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYLLWVFTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Eosinophil peroxidase ELISA Kit
MBS760340-01 48 Well

Human Eosinophil peroxidase ELISA Kit

Sign In for Pricing
View Details
Human Eosinophil peroxidase ELISA Kit
MBS760340-02 96 Well

Human Eosinophil peroxidase ELISA Kit

Sign In for Pricing
View Details
Human Eosinophil peroxidase ELISA Kit
MBS760340-03 5x 96 Well

Human Eosinophil peroxidase ELISA Kit

Sign In for Pricing
View Details
Human Eosinophil peroxidase ELISA Kit
MBS760340-04 10x 96 Well

Human Eosinophil peroxidase ELISA Kit

Sign In for Pricing
View Details
Bis (hexafluoroacetylacetonato) copper (II) Hydrate
267164-01 2 g

Bis (hexafluoroacetylacetonato) copper (II) Hydrate

Sign In for Pricing
View Details
Bis (hexafluoroacetylacetonato) copper (II) Hydrate
267164-02 5 g

Bis (hexafluoroacetylacetonato) copper (II) Hydrate

Sign In for Pricing
View Details