Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC23 Peptide - C-terminal region

TTC23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HCC-8

UniProt

Q5W5X9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC23 Rabbit Polyclonal Antibody (orb587786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075056

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (OTI3H5) [HRP]
NBP2-73686H 0.1 mL

Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (OTI3H5) [HRP]

Sign In for Pricing
View Details
Serum Module Complete
U10083 1 Each

Serum Module Complete

Sign In for Pricing
View Details
Amiprilose hydrochloride
MA44344-01 25 mg

Amiprilose hydrochloride

Sign In for Pricing
View Details
Amiprilose hydrochloride
MA44344-02 50 mg

Amiprilose hydrochloride

Sign In for Pricing
View Details
Amiprilose hydrochloride
MA44344-03 100 mg

Amiprilose hydrochloride

Sign In for Pricing
View Details
Amiprilose hydrochloride
MA44344-04 250 mg

Amiprilose hydrochloride

Sign In for Pricing
View Details