Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC23 Peptide - C-terminal region

TTC23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HCC-8

UniProt

Q5W5X9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC23 Rabbit Polyclonal Antibody (orb587786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075056

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Capsid assembly inhibitor
orb2813726-01 50 mg

Capsid assembly inhibitor

Sign In for Pricing
View Details
Capsid assembly inhibitor
orb2813726-02 10 mg

Capsid assembly inhibitor

Sign In for Pricing
View Details
PDIA4 Antibody
E51A12532 100 µL

PDIA4 Antibody

Sign In for Pricing
View Details
TRIM32 Rabbit Polyclonal Antibody (Fluoro550)
orb3107181 100 µg

TRIM32 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Porcine adenosine deaminase (ADA) ELISA Kit
MBS1600906-01 48 Well

Porcine adenosine deaminase (ADA) ELISA Kit

Sign In for Pricing
View Details
Porcine adenosine deaminase (ADA) ELISA Kit
MBS1600906-02 96 Well

Porcine adenosine deaminase (ADA) ELISA Kit

Sign In for Pricing
View Details