Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCFD1 Peptide - C-terminal region

SCFD1 Peptide - C-terminal region

Product Specifications

UniProt

Q8WVM8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCFD1 Rabbit Polyclonal Antibody (orb582919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-GTPBP4-3xFLAG-Neo Plasmid
PVT81021 2 µg

PCMV-GTPBP4-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
RAB13 Rabbit Polyclonal Antibody (PE)
orb2619126 100 µg

RAB13 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
KRAS G13C Homozygous HCT116 Cancer Biomarker Mutant Cell Line
SL550160 1 Vial

KRAS G13C Homozygous HCT116 Cancer Biomarker Mutant Cell Line

Sign In for Pricing
View Details
IL7R Human
32-6438-5 5 µg

IL7R Human

Sign In for Pricing
View Details
MYO16 Rabbit Polyclonal Antibody
orb629102-01 50 µg

MYO16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYO16 Rabbit Polyclonal Antibody
orb629102-02 100 µg

MYO16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details