Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCFD1 Peptide - C-terminal region

SCFD1 Peptide - C-terminal region

Product Specifications

UniProt

Q8WVM8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCFD1 Rabbit Polyclonal Antibody (orb582919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YFDPKMLRGNDSSVPRNKNPFQEAIVFVVGGGNYIEYQNLVDYIKGKQGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATS2L (NM_001282743) Human Tagged ORF Clone
RC238572 10 µg

SPATS2L (NM_001282743) Human Tagged ORF Clone

Sign In for Pricing
View Details
HMGCS2 Rabbit mAb
F2461-100uL*2 2x 100 μL

HMGCS2 Rabbit mAb

Sign In for Pricing
View Details
Lentiviral human SULT2B1 shRNA (UAS) - Lentiviral human SULT2B1 shRNA (UAS, GFP) plasmid
GTR15333325 1 Vial

Lentiviral human SULT2B1 shRNA (UAS) - Lentiviral human SULT2B1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
TC-I 2014 10mM * 1mL in DMSO
A19793-10mM-D 10 mM x 1mL in DMSO

TC-I 2014 10mM * 1mL in DMSO

Sign In for Pricing
View Details
hsa-miR-138-5p miRNA Mimic
MCH01301 2x 2.5 nmol

hsa-miR-138-5p miRNA Mimic

Sign In for Pricing
View Details
Mouse MPV17L2 shRNA Plasmid
abx982126-01 150 µg

Mouse MPV17L2 shRNA Plasmid

Sign In for Pricing
View Details