Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNAPC2 Peptide - C-terminal region

SNAPC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PTFDELTA, SNAP45

UniProt

Q13487

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNAPC2 Rabbit Polyclonal Antibody (orb576099) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003074

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPLLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fusion Glycoprotein F0 Polyclonal Antibody
A64438-020 20 µL

Fusion Glycoprotein F0 Polyclonal Antibody

Sign In for Pricing
View Details
6-cyclohexylhexanoic Acid
TRC-C994565-100MG 100 mg

6-cyclohexylhexanoic Acid

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Uracil-DNA glycosylase (ung)
MBS1034303-01 0.02 mg (E-Coli)

Recombinant Borrelia burgdorferi Uracil-DNA glycosylase (ung)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Uracil-DNA glycosylase (ung)
MBS1034303-02 0.1 mg (E-Coli)

Recombinant Borrelia burgdorferi Uracil-DNA glycosylase (ung)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Uracil-DNA glycosylase (ung)
MBS1034303-03 0.02 mg (Yeast)

Recombinant Borrelia burgdorferi Uracil-DNA glycosylase (ung)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Uracil-DNA glycosylase (ung)
MBS1034303-04 0.1 mg (Yeast)

Recombinant Borrelia burgdorferi Uracil-DNA glycosylase (ung)

Sign In for Pricing
View Details