Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHR Peptide - C-terminal region

GHR Peptide - C-terminal region

Product Specifications

Product Name Alternative

GHBP

UniProt

P10912

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GHR Rabbit Polyclonal Antibody (orb579099) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229391

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYFPW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(Pentyl-d11)-3-(4-ethyl-naphthoyl)indole JWH 210-d11 (1.0mg/ml in Acetonitrile)
TRC-KIT6890-1X1ML 1 mL

1-(Pentyl-d11)-3-(4-ethyl-naphthoyl)indole JWH 210-d11 (1.0mg/ml in Acetonitrile)

Sign In for Pricing
View Details
NHLH2 (NM_001111061) Human Over-expression Lysate
LC426348 20 µg

NHLH2 (NM_001111061) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant ApoA1 Antibody (Biotin)
RB-8573-01 50 μL

Recombinant ApoA1 Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant ApoA1 Antibody (Biotin)
RB-8573-02 100 µL

Recombinant ApoA1 Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant ApoA1 Antibody (Biotin)
RB-8573-03 1 mL

Recombinant ApoA1 Antibody (Biotin)

Sign In for Pricing
View Details
Psma7 Mouse Gene Knockout Kit (CRISPR)
KN514095 1 Kit

Psma7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details