Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM3B Peptide - middle region

FAM3B Peptide - middle region

Product Specifications

Product Name Alternative

2-21, C21orf11, C21orf76, ORF9, PANDER

UniProt

P58499

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM3B Rabbit Polyclonal Antibody (orb579607) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996847

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-tert-Butyl-2-oxo-1,2-dihydropyridine-3-carboxylic acid
RCA15826-01 50 mg

1-tert-Butyl-2-oxo-1,2-dihydropyridine-3-carboxylic acid

Sign In for Pricing
View Details
1-tert-Butyl-2-oxo-1,2-dihydropyridine-3-carboxylic acid
RCA15826-02 0.5 g

1-tert-Butyl-2-oxo-1,2-dihydropyridine-3-carboxylic acid

Sign In for Pricing
View Details
Mouse Epidermal growth factor receptor 2,HER2 ELISA KIT
JOT-EK0994Mo-01 96 Well

Mouse Epidermal growth factor receptor 2,HER2 ELISA KIT

Sign In for Pricing
View Details
Mouse Epidermal growth factor receptor 2,HER2 ELISA KIT
JOT-EK0994Mo-02 48 Well

Mouse Epidermal growth factor receptor 2,HER2 ELISA KIT

Sign In for Pricing
View Details
YEATS2 HDR Plasmid (h)
sc-407968-HDR 20 µg

YEATS2 HDR Plasmid (h)

Sign In for Pricing
View Details
2-bromo-4-chloro-6-iodophenol
OR1081767-01 250 mg

2-bromo-4-chloro-6-iodophenol

Sign In for Pricing
View Details