Rprd1b Peptide - C-terminal region
Rprd1b Peptide - C-terminal region
Product Specifications
Product Name Alternative
2610304G08Rik, 2810446G03Rik, Crept
UniProt
Q9CSU0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rprd1b Rabbit Polyclonal Antibody (orb583601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_081710
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2167548-01 0.1 mL
Biotin-Linked Monoclonal Antibody to GATA Binding Protein 3 (GATA3)
Sign In for Pricing
View Details MBS2167548-02 0.2 mL
Biotin-Linked Monoclonal Antibody to GATA Binding Protein 3 (GATA3)
Sign In for Pricing
View Details MBS2167548-03 0.5 mL
Biotin-Linked Monoclonal Antibody to GATA Binding Protein 3 (GATA3)
Sign In for Pricing
View Details MBS2167548-04 1 mL
Biotin-Linked Monoclonal Antibody to GATA Binding Protein 3 (GATA3)
Sign In for Pricing
View Details