Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rprd1b Peptide - C-terminal region

Rprd1b Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610304G08Rik, 2810446G03Rik, Crept

UniProt

Q9CSU0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rprd1b Rabbit Polyclonal Antibody (orb583601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081710

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKNOX2 sgRNA CRISPR Lentivector (Human) (Target 2)
K1657803 1.0 µg DNA

PKNOX2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CACNA1b Protein Vector (Rat) (pPB-C-His)
PV257038 500 ng

CACNA1b Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Monoclonal FOXO4/Afx Antibody (Human)
B2022844 100 µL

Rabbit Monoclonal FOXO4/Afx Antibody (Human)

Sign In for Pricing
View Details
BPGM Protein Vector (Human) (pPM-N-D-C-HA)
PV327332 500 ng

BPGM Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
GLT25D2 Rabbit Polyclonal Antibody (Cy5)
orb925735 100 µL

GLT25D2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Human BAIAP2L1 knockdown cell line
ABC-KD1326 1 Vial

Human BAIAP2L1 knockdown cell line

Sign In for Pricing
View Details