Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rprd1b Peptide - C-terminal region

Rprd1b Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610304G08Rik, 2810446G03Rik, Crept

UniProt

Q9CSU0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rprd1b Rabbit Polyclonal Antibody (orb583601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081710

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAP2B AssayLite™ Antibody (PerCP Conjugate)
33475-05171 5x 30 µg

Human RAP2B AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
TLR8, CT (Toll-like Receptor 8, CD288) (APC)
MBS6503049-01 0.2 mL

TLR8, CT (Toll-like Receptor 8, CD288) (APC)

Sign In for Pricing
View Details
TLR8, CT (Toll-like Receptor 8, CD288) (APC)
MBS6503049-02 5x 0.2 mL

TLR8, CT (Toll-like Receptor 8, CD288) (APC)

Sign In for Pricing
View Details
AZDye555 NT Labeling Kit, L pack
JBS-PP-305L-AZ555 50 Reactions

AZDye555 NT Labeling Kit, L pack

Sign In for Pricing
View Details
Inhibin Beta B Chain (INHBB) Antibody
abx403658-01 100 µL

Inhibin Beta B Chain (INHBB) Antibody

Sign In for Pricing
View Details
Inhibin Beta B Chain (INHBB) Antibody
abx403658-02 200 µL

Inhibin Beta B Chain (INHBB) Antibody

Sign In for Pricing
View Details