Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rprd1b Peptide - C-terminal region

Rprd1b Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610304G08Rik, 2810446G03Rik, Crept

UniProt

Q9CSU0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rprd1b Rabbit Polyclonal Antibody (orb583601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081710

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal OLT-2 Antibody (2564C) [PE/Atto594]
FAB10059PEATT594 0.1 mL

Rabbit Monoclonal OLT-2 Antibody (2564C) [PE/Atto594]

Sign In for Pricing
View Details
PARVA antibody
70R-19122 50 ul

PARVA antibody

Sign In for Pricing
View Details
RAET1E sgRNA CRISPR Lentivector set (Human)
K1780401 3x 1.0 µg

RAET1E sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Phospho-Smad2 (Ser245 + Ser250 + Ser255) Rabbit Polyclonal Antibody (PE-Cy5.5)
orb902243 100 µL

Phospho-Smad2 (Ser245 + Ser250 + Ser255) Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
MGEA5 Recombinant Antibody
bsm-61935R-01 20 µL

MGEA5 Recombinant Antibody

Sign In for Pricing
View Details
MGEA5 Recombinant Antibody
bsm-61935R-02 100 µL

MGEA5 Recombinant Antibody

Sign In for Pricing
View Details