Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EYA1 Peptide - N-terminal region

EYA1 Peptide - N-terminal region

Product Specifications

UniProt

E5RIQ7

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EYA1 Rabbit Polyclonal Antibody (orb329657) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDLTSPHSRLSGSSESPSGPKLGNSHINSNSMTPNGTEVKTEPMSSSETA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)
MBS2146790-01 0.1 mL

APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)
MBS2146790-02 0.2 mL

APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)
MBS2146790-03 0.5 mL

APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)
MBS2146790-04 1 mL

APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)
MBS2146790-05 5 mL

APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)
MBS2146790-06 5x 5 mL

APC-Linked Polyclonal Antibody to Transcription Factor P65 (NFKB3)

Sign In for Pricing
View Details