Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FERMT1 Peptide - C-terminal region

FERMT1 Peptide - C-terminal region

Product Specifications

UniProt

Q9BQL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FERMT1 Rabbit Polyclonal Antibody (orb578494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-Butyl 3- (o-tolyl) piperazine-1-carboxylate
OR1046439-01 100 mg

Tert-Butyl 3- (o-tolyl) piperazine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 3- (o-tolyl) piperazine-1-carboxylate
OR1046439-02 250 mg

Tert-Butyl 3- (o-tolyl) piperazine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 3- (o-tolyl) piperazine-1-carboxylate
OR1046439-03 1 g

Tert-Butyl 3- (o-tolyl) piperazine-1-carboxylate

Sign In for Pricing
View Details
(±) -Lisofylline-d4
HY-126042S4 1 Each

(±) -Lisofylline-d4

Sign In for Pricing
View Details
Anti-Mouse NOTCH2/3 Antibody (59R1)
MBS1569747-01 0.05 mg

Anti-Mouse NOTCH2/3 Antibody (59R1)

Sign In for Pricing
View Details
Anti-Mouse NOTCH2/3 Antibody (59R1)
MBS1569747-02 0.1 mg

Anti-Mouse NOTCH2/3 Antibody (59R1)

Sign In for Pricing
View Details