Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FERMT1 Peptide - C-terminal region

FERMT1 Peptide - C-terminal region

Product Specifications

UniProt

Q9BQL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FERMT1 Rabbit Polyclonal Antibody (orb578494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTBR Recombinant Protein
OPCD05053-200UG 200 µg

LTBR Recombinant Protein

Sign In for Pricing
View Details
EDG-3 CRISPR Activation Plasmid (m2)
sc-420105-ACT-2 20 µg

EDG-3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal PDCL2 Antibody [Alexa Fluor 405]
NBP2-81765AF405 0.1 mL

Rabbit Polyclonal PDCL2 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
CLEC10A Rabbit pAb
E45R18664N 50 ul

CLEC10A Rabbit pAb

Sign In for Pricing
View Details
Research Grade Posdinemab
HY086066-01 100 µg

Research Grade Posdinemab

Sign In for Pricing
View Details
Research Grade Posdinemab
HY086066-02 1 mg

Research Grade Posdinemab

Sign In for Pricing
View Details