Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMED5 Peptide - C-terminal region

TMED5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-100, p28

UniProt

Q9Y3A6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMED5 Rabbit Polyclonal Antibody (orb327117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057124

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: INSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Japanese Encephalitis IgG, JEV IgG GENLISA ELISA
KLB0008 96 Well

Bovine Japanese Encephalitis IgG, JEV IgG GENLISA ELISA

Sign In for Pricing
View Details
Araloside V
CS-O-47280 1 Each

Araloside V

Sign In for Pricing
View Details
Potassium Ferricyanide 5%
40100324-2 500 mL

Potassium Ferricyanide 5%

Sign In for Pricing
View Details
Orexin receptor 1+2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1095R-BF594-01 20 µL

Orexin receptor 1+2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Orexin receptor 1+2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1095R-BF594-02 100 µL

Orexin receptor 1+2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Resorufin alpha-D-galactopyranoside
14021-AAT 5 mg

Resorufin alpha-D-galactopyranoside

Sign In for Pricing
View Details