TMED5 Peptide - C-terminal region
TMED5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CGI-100, p28
UniProt
Q9Y3A6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMED5 Rabbit Polyclonal Antibody (orb327117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057124
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: INSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2490943 100 µL
LULL1/TOR1AIP2 Rabbit Polyclonal Antibody (BF555)
Sign In for Pricing
View Details 
LKU603475 96 Tests
NLR Family, Pyrin Domain Containing Protein 3 (NLRP3) Magnetic Luminex Assay Kit
Sign In for Pricing
View Details 
46592124 3x 1.0µg DNA
TGFB2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
Sign In for Pricing
View Details