Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIK2 Peptide - C-terminal region

GRIK2 Peptide - C-terminal region

Product Specifications

UniProt

Q13002

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRIK2 Rabbit Polyclonal Antibody (orb575526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP1B1 discontinued
306285 100 µL

AP1B1 discontinued

Sign In for Pricing
View Details
Anti-PURA Antibody Picoband® FITC Conjugated
A02520-1-FITC 100 µg/Vial

Anti-PURA Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
Swine Receptor Antagonist (IL-1RA) ELISA
DIY1947S-01 1 Pack (10 Plates)

Swine Receptor Antagonist (IL-1RA) ELISA

Sign In for Pricing
View Details
Swine Receptor Antagonist (IL-1RA) ELISA
DIY1947S-02 1 Pack (20 Plates)

Swine Receptor Antagonist (IL-1RA) ELISA

Sign In for Pricing
View Details
PGLYRP4 Antibody
OACA03437-50UG 50 µg

PGLYRP4 Antibody

Sign In for Pricing
View Details
Anti-Fbx32 Antibody (4A434)
TMAB-00661-01 25 µL

Anti-Fbx32 Antibody (4A434)

Sign In for Pricing
View Details