Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC16A7 Peptide - C-terminal region

SLC16A7 Peptide - C-terminal region

Product Specifications

UniProt

F5H843

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC16A7 Rabbit Polyclonal Antibody (orb578975) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Human CD26-UNLB
MBS674328-01 0.1 mg

Mouse Anti-Human CD26-UNLB

Sign In for Pricing
View Details
Mouse Anti-Human CD26-UNLB
MBS674328-02 5x 0.1 mg

Mouse Anti-Human CD26-UNLB

Sign In for Pricing
View Details
MEK1 (Ab-217) Antibody
E021203-2 100 µg -100 µL

MEK1 (Ab-217) Antibody

Sign In for Pricing
View Details
Anti-GKN1 Antibody Picoband®
A07594-carrier-free 100 µg/Vial

Anti-GKN1 Antibody Picoband®

Sign In for Pricing
View Details
Recombinant Brucella ovis ATP synthase subunit delta (atpH)
MBS1007828-01 0.05 mg (E-Coli)

Recombinant Brucella ovis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Brucella ovis ATP synthase subunit delta (atpH)
MBS1007828-02 0.05 mg (Yeast)

Recombinant Brucella ovis ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details