Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC16A7 Peptide - C-terminal region

SLC16A7 Peptide - C-terminal region

Product Specifications

UniProt

F5H843

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC16A7 Rabbit Polyclonal Antibody (orb578975) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABRR1 (NM_002042) Human Tagged ORF Clone
RC217506 10 µg

GABRR1 (NM_002042) Human Tagged ORF Clone

Sign In for Pricing
View Details
Scel (NM_022886) Mouse Tagged Lenti ORF Clone
MR215358L4 10 µg

Scel (NM_022886) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPRML Protein Vector (Rat) (pPM-C-HA)
PV302376 500 ng

RPRML Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RNF214 CRISPR Activation Plasmid (m2)
sc-433444-ACT-2 20 µg

RNF214 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
5-Nitro-2,3,3-trimethylindolenine
3484-22-8 1 Each

5-Nitro-2,3,3-trimethylindolenine

Sign In for Pricing
View Details
NOTCH3 (NM_000435) Human 3' UTR Clone
SC212056 10 µg

NOTCH3 (NM_000435) Human 3' UTR Clone

Sign In for Pricing
View Details