Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART5 Peptide - N-terminal region

ART5 Peptide - N-terminal region

Product Specifications

UniProt

Q96L15

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ART5 Rabbit Polyclonal Antibody (orb580606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bglap Mouse Gene Knockout Kit (CRISPR)
KN502150 1 Kit

Bglap Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Histone H3 (acetyl K27) Recombinant Rabbit monoclonal Antibody
HA751495 100 µL

Histone H3 (acetyl K27) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
XRCC4 Human Gene Knockout Kit (CRISPR)
KN204783RB 1 Kit

XRCC4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SIRPB2 (NM_001122962) Human Recombinant Protein
TP325507M 100 µg

SIRPB2 (NM_001122962) Human Recombinant Protein

Sign In for Pricing
View Details
NUCKS1 Human Gene Knockout Kit (CRISPR)
KN401704 1 Kit

NUCKS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Polystyrene C4 PHB
HB04508013.100G 100 g

Polystyrene C4 PHB

Sign In for Pricing
View Details