Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFHR2 Peptide - C-terminal region

CFHR2 Peptide - C-terminal region

Product Specifications

UniProt

P36980

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFHR2 Rabbit Polyclonal Antibody (orb582479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil cationic protein 1
orb1642056-01 50 µg

Eosinophil cationic protein 1

Sign In for Pricing
View Details
Eosinophil cationic protein 1
orb1642056-02 100 µg

Eosinophil cationic protein 1

Sign In for Pricing
View Details
Eosinophil cationic protein 1
orb1642056-03 1 mg

Eosinophil cationic protein 1

Sign In for Pricing
View Details
Rat AIF-1 (Allograft inflammatory factor 1) ELISA Kit
MBS7606868-01 48 Well

Rat AIF-1 (Allograft inflammatory factor 1) ELISA Kit

Sign In for Pricing
View Details
Rat AIF-1 (Allograft inflammatory factor 1) ELISA Kit
MBS7606868-02 96 Well

Rat AIF-1 (Allograft inflammatory factor 1) ELISA Kit

Sign In for Pricing
View Details
Rat AIF-1 (Allograft inflammatory factor 1) ELISA Kit
MBS7606868-03 5x 96 Well

Rat AIF-1 (Allograft inflammatory factor 1) ELISA Kit

Sign In for Pricing
View Details