CFHR2 Peptide - C-terminal region
CFHR2 Peptide - C-terminal region
Product Specifications
UniProt
P36980
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CFHR2 Rabbit Polyclonal Antibody (orb582479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15190055 1 Vial
Lentiviral mouse Gabrb1 shRNA (UAS) - Lentiviral mouse Gabrb1 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 
MBS6502033-01 0.2 mL
TBP, ID (TATA-box-binding Protein, TATA-box Factor, TATA-binding Factor, TATA Sequence-binding Protein, Transcription Initiation Factor TFIID TBP Subunit, TFIID, TF2D, GTF2D1) (FITC)
Sign In for Pricing
View Details