Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC27 Peptide - C-terminal region

CDC27 Peptide - C-terminal region

Product Specifications

UniProt

F6QPS0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC27 Rabbit Polyclonal Antibody (orb584281) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ILT2/CD85j/LILRB1 Antibody (GHI/75) [PE/Cy7]
NBP2-50474PECY7 0.1 mL

Mouse Monoclonal ILT2/CD85j/LILRB1 Antibody (GHI/75) [PE/Cy7]

Sign In for Pricing
View Details
POMP Recombinant Protein (Mouse)
RP163460 100 µg

POMP Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Phospho-HSP27 (Ser82) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-3180R-BF750 100 µL

Phospho-HSP27 (Ser82) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Shigella dysenteriae (MaxLight 550) discontinued
S1013-12C-ML550 100 µL

Shigella dysenteriae (MaxLight 550) discontinued

Sign In for Pricing
View Details
PPP1R11 Antibody
E11-18004C 100 µg

PPP1R11 Antibody

Sign In for Pricing
View Details
Cefalotin
317381 1.0g

Cefalotin

Sign In for Pricing
View Details