Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC27 Peptide - C-terminal region

CDC27 Peptide - C-terminal region

Product Specifications

UniProt

F6QPS0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDC27 Rabbit Polyclonal Antibody (orb584281) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SYT11 Antibody [Alexa Fluor 594]
NBP2-98496AF594 0.1 mL

Rabbit Polyclonal SYT11 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Rabbit Polyclonal WDR18 Antibody [DyLight 550]
NBP2-81877R 0.1 mL

Rabbit Polyclonal WDR18 Antibody [DyLight 550]

Sign In for Pricing
View Details
Rad51D CRISPR/Cas9 KO Plasmid (h)
sc-408085 20 µg

Rad51D CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
CRISPLD2 Peptide
orb2014455 100 µg

CRISPLD2 Peptide

Sign In for Pricing
View Details
Zinc Finger Protein 583 (ZNF583) Antibody (FITC)
abx306182-01 20 µg

Zinc Finger Protein 583 (ZNF583) Antibody (FITC)

Sign In for Pricing
View Details
Zinc Finger Protein 583 (ZNF583) Antibody (FITC)
abx306182-02 50 µg

Zinc Finger Protein 583 (ZNF583) Antibody (FITC)

Sign In for Pricing
View Details