Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6K6 Peptide - C-terminal region

OR6K6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1-21

UniProt

Q8NGW6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6K6 Rabbit Polyclonal Antibody (orb587627) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005184

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYSVFWDTAIAVTFVILAPFFNPIIYSLKNKDMKEAIGRLFHYQKRAGWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stathmin 1 Phospho-Ser25 (STMN1 pS25) Antibody
abx333240 100 µL

Stathmin 1 Phospho-Ser25 (STMN1 pS25) Antibody

Sign In for Pricing
View Details
SNED1 (NM_001080437) Human Over-expression Lysate
LS025992 100 µg

SNED1 (NM_001080437) Human Over-expression Lysate

Sign In for Pricing
View Details
CBR4 siRNA (Human)
orb1854607-01 15 nmol

CBR4 siRNA (Human)

Sign In for Pricing
View Details
CBR4 siRNA (Human)
orb1854607-02 30 nmol

CBR4 siRNA (Human)

Sign In for Pricing
View Details
ZCCHC4 Rabbit pAb, PerCP-Cy7 conjugated
orb2887948 100 µL

ZCCHC4 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Human ATP1B2
P2858-01 50 µg

Recombinant Human ATP1B2

Sign In for Pricing
View Details