Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6K6 Peptide - C-terminal region

OR6K6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1-21

UniProt

Q8NGW6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6K6 Rabbit Polyclonal Antibody (orb587627) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005184

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYSVFWDTAIAVTFVILAPFFNPIIYSLKNKDMKEAIGRLFHYQKRAGWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf47 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
14737111 3x 1.0 µg

C8orf47 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RPS26P57 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV784593 1.0 µg DNA

RPS26P57 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Porcine Anoctamin-5 (ANO5) ELISA Kit
MBS7233838-01 48 Well

Porcine Anoctamin-5 (ANO5) ELISA Kit

Sign In for Pricing
View Details
Porcine Anoctamin-5 (ANO5) ELISA Kit
MBS7233838-02 96 Well

Porcine Anoctamin-5 (ANO5) ELISA Kit

Sign In for Pricing
View Details
Porcine Anoctamin-5 (ANO5) ELISA Kit
MBS7233838-03 5x 96 Well

Porcine Anoctamin-5 (ANO5) ELISA Kit

Sign In for Pricing
View Details
Porcine Anoctamin-5 (ANO5) ELISA Kit
MBS7233838-04 10x 96 Well

Porcine Anoctamin-5 (ANO5) ELISA Kit

Sign In for Pricing
View Details