INTS4 Peptide - C-terminal region
INTS4 Peptide - C-terminal region
Product Specifications
UniProt
Q96HW7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTS4 Rabbit Polyclonal Antibody (orb581403) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QNTVKVQVLYPDGQAQMIHPKPADFRNPGPGRHRLITQVYLSHTAWTEAC
More Discoveries
Explore Other Products
Browse additional items from our catalog
B2025069 1 mg
Donkey Polyclonal Sheep IgG (H&L) Antibody Fluorescein Conjugated Pre-Adsorbed
Sign In for Pricing
View Details 
MBS1031987 Inquire
Recombinant Aspergillus niger Structure-specific endonuclease subunit slx4 (slx4), partial
Sign In for Pricing
View Details 
131281-HRP 100 µL
Phosphodiesterase 9A (PDE9A, High Affinity cGMP-specific 3',5'-cyclic Phosphodiesterase 9A, FLJ90181, HSPDE9A2) (HRP)
Sign In for Pricing
View Details 
bs-14295R-BF647 100 µL
DGKB Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
Sign In for Pricing
View Details LV707301 1.0 µg DNA
ALKBH3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details