INTS4 Peptide - C-terminal region
INTS4 Peptide - C-terminal region
Product Specifications
UniProt
Q96HW7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INTS4 Rabbit Polyclonal Antibody (orb581403) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QNTVKVQVLYPDGQAQMIHPKPADFRNPGPGRHRLITQVYLSHTAWTEAC
More Discoveries
Explore Other Products
Browse additional items from our catalog
MPC1341K Each
Magic™ Membrane Protein Human NRG1 (Neuregulin 1) Full Length
Sign In for Pricing
View Details 
212115-01 50 µL
MTOR, phosphorylated (S2448) (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1) discontinued
Sign In for Pricing
View Details 
212115-02 100 µL
MTOR, phosphorylated (S2448) (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1) discontinued
Sign In for Pricing
View Details 212115-03 200 µL
MTOR, phosphorylated (S2448) (Mammalian Target of Rapamycin, FRAP, FRAP1, FRAP2, RAFT1, RAPT1) discontinued
Sign In for Pricing
View Details NBP2-54355APCCY7 0.1 mL
Rabbit Monoclonal CD34 Antibody (HPCA1/1806R) [Allophycocyanin/Cy7]
Sign In for Pricing
View Details