Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8K5 Peptide - C-terminal region

OR8K5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-174

UniProt

Q8NH50

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8K5 Rabbit Polyclonal Antibody (orb587654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004058

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MYMQPNSTHFFDTDKMASVFYTLVIPMLNPLIYSLRNEEVKNAFYKLFEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human Stromelysin-1 polyclonal Antibody, HRP-conjugated
MBS1489698-01 0.05 mg

Rabbit anti-human Stromelysin-1 polyclonal Antibody, HRP-conjugated

Sign In for Pricing
View Details
Rabbit anti-human Stromelysin-1 polyclonal Antibody, HRP-conjugated
MBS1489698-02 0.1 mg

Rabbit anti-human Stromelysin-1 polyclonal Antibody, HRP-conjugated

Sign In for Pricing
View Details
Rabbit anti-human Stromelysin-1 polyclonal Antibody, HRP-conjugated
MBS1489698-03 5x 0.1 mg

Rabbit anti-human Stromelysin-1 polyclonal Antibody, HRP-conjugated

Sign In for Pricing
View Details
Notch1 Blocking Peptide (C-term)
MBS9229960-01 0.5 mg

Notch1 Blocking Peptide (C-term)

Sign In for Pricing
View Details
Notch1 Blocking Peptide (C-term)
MBS9229960-02 5x 0.5 mg

Notch1 Blocking Peptide (C-term)

Sign In for Pricing
View Details
Ccdc77 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6197002 1.0 µg DNA

Ccdc77 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details