Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8K5 Peptide - C-terminal region

OR8K5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-174

UniProt

Q8NH50

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8K5 Rabbit Polyclonal Antibody (orb587654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004058

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MYMQPNSTHFFDTDKMASVFYTLVIPMLNPLIYSLRNEEVKNAFYKLFEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC8A3 Protein Lysate (Human) with C-Ha Tag
44291031 100 µg

SLC8A3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
ZNF655 Rabbit Polyclonal Antibody (Biotin)
orb2136383 100 µL

ZNF655 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Frg1 3'UTR Lenti-reporter-Luc Vector
20944086 1.0 µg

Frg1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Porcine Mannose Phosphate Isomerase ELISA Kit
MBS753581-01 48 Well

Porcine Mannose Phosphate Isomerase ELISA Kit

Sign In for Pricing
View Details
Porcine Mannose Phosphate Isomerase ELISA Kit
MBS753581-02 96 Well

Porcine Mannose Phosphate Isomerase ELISA Kit

Sign In for Pricing
View Details
Porcine Mannose Phosphate Isomerase ELISA Kit
MBS753581-03 5x 96 Well

Porcine Mannose Phosphate Isomerase ELISA Kit

Sign In for Pricing
View Details