OR9I1 Peptide - C-terminal region
OR9I1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-228
UniProt
Q8NGQ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR9I1 Rabbit Polyclonal Antibody (orb327060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005211
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VKSSGGRAKTFSTCASHITAVALFFGALIFMYLQSGSGKSLEEDKVVSVF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Wyb0897-inquire Inquire
Recombinant Salmonella hutU Protein (aa 1-561) (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Sign In for Pricing
View Details 
PA88666HU-01 50 µg
Rabbit Anti-Human A Cyclase V/VI Polyclonal Antibody
Sign In for Pricing
View Details PA88666HU-02 100 µg
Rabbit Anti-Human A Cyclase V/VI Polyclonal Antibody
Sign In for Pricing
View Details PA88666HU-03 500 µg
Rabbit Anti-Human A Cyclase V/VI Polyclonal Antibody
Sign In for Pricing
View Details PA88666HU-04 1 mg
Rabbit Anti-Human A Cyclase V/VI Polyclonal Antibody
Sign In for Pricing
View Details