Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR9I1 Peptide - C-terminal region

OR9I1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-228

UniProt

Q8NGQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR9I1 Rabbit Polyclonal Antibody (orb327060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005211

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKSSGGRAKTFSTCASHITAVALFFGALIFMYLQSGSGKSLEEDKVVSVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin Beta 6 (TUBB6) Antibody (FITC)
abx311513-01 20 µg

Tubulin Beta 6 (TUBB6) Antibody (FITC)

Sign In for Pricing
View Details
Tubulin Beta 6 (TUBB6) Antibody (FITC)
abx311513-02 50 µg

Tubulin Beta 6 (TUBB6) Antibody (FITC)

Sign In for Pricing
View Details
Tubulin Beta 6 (TUBB6) Antibody (FITC)
abx311513-03 100 µg

Tubulin Beta 6 (TUBB6) Antibody (FITC)

Sign In for Pricing
View Details
Tubulin Beta 6 (TUBB6) Antibody (FITC)
abx311513-04 200 µg

Tubulin Beta 6 (TUBB6) Antibody (FITC)

Sign In for Pricing
View Details
Tubulin Beta 6 (TUBB6) Antibody (FITC)
abx311513-05 1 mg

Tubulin Beta 6 (TUBB6) Antibody (FITC)

Sign In for Pricing
View Details
ZNF565 (NM_152477) Human Untagged Clone
SC100924 10 µg

ZNF565 (NM_152477) Human Untagged Clone

Sign In for Pricing
View Details