OR10H5 Peptide - C-terminal region
OR10H5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR19-25, OR19-26
UniProt
Q8NGA6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR10H5 Rabbit Polyclonal Antibody (orb587676) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004466
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NKAFSTCASHLTVVVVHYGFASVIYLKPKGPQSPEGDTLMGITYTVLTPF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
B0130-26 100 µL
Basic Hair Keratin, K84 (KRT84, Keratin 84, HB4, Hb-4, K84, Keratin, Type II Cuticular Hb4, Keratin-84, KRTHB4, Type II Hair Keratin Hb4) (Not for Export EU)
Sign In for Pricing
View Details 
MBS1128513 Inquire
Recombinant Schizosaccharomyces pombe Conserved oligomeric Golgi complex subunit 6 (cog6), partial
Sign In for Pricing
View Details 1181-3510 1920 Tips
TipOne RPT 10 uL ultra low retention filter tip refill starter pack. Includes one box with ten racks of filter tips and one box of ten filter tip refill cassettes (total 1920 tips) . Sterile.
Sign In for Pricing
View Details 57708111 3x 1.0 µg
FTHL7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details