Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10H5 Peptide - C-terminal region

OR10H5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR19-25, OR19-26

UniProt

Q8NGA6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10H5 Rabbit Polyclonal Antibody (orb587676) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004466

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKAFSTCASHLTVVVVHYGFASVIYLKPKGPQSPEGDTLMGITYTVLTPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Alanine Transaminase (ALT) CLIA Kit
abx195715 96 Tests

Human Alanine Transaminase (ALT) CLIA Kit

Sign In for Pricing
View Details
2-Fluoro-6- (methoxycarbonyl) benzoic acid
PC110967-01 100 mg

2-Fluoro-6- (methoxycarbonyl) benzoic acid

Sign In for Pricing
View Details
2-Fluoro-6- (methoxycarbonyl) benzoic acid
PC110967-02 250 mg

2-Fluoro-6- (methoxycarbonyl) benzoic acid

Sign In for Pricing
View Details
2-Fluoro-6- (methoxycarbonyl) benzoic acid
PC110967-03 1 g

2-Fluoro-6- (methoxycarbonyl) benzoic acid

Sign In for Pricing
View Details
Stachyose
sc-286780A 5 g

Stachyose

Sign In for Pricing
View Details
C17orf18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0316305 3x 1.0 µg

C17orf18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details