Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUD1 Peptide - C-terminal region

OTUD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DUBA7, OTDC1

UniProt

Q5VV17

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTUD1 Rabbit Polyclonal Antibody (orb587697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138845

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM1 [ST0487] Antibody
OM637294-01 100 µL

ICAM1 [ST0487] Antibody

Sign In for Pricing
View Details
ICAM1 [ST0487] Antibody
OM637294-02 20 µL

ICAM1 [ST0487] Antibody

Sign In for Pricing
View Details
ICAM1 [ST0487] Antibody
OM637294-03 50 µL

ICAM1 [ST0487] Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: left
CS531162 5x 5 µm

Frozen Tissue Sections, Colon: left

Sign In for Pricing
View Details
XWNPEP CRISPR All-in-one AAV vector set (with saCas9)(Human)
50575151 3x 1.0 µg DNA

XWNPEP CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Porphyromonas gingivalis
Oneq-H762-100D 100 Reactions

Porphyromonas gingivalis

Sign In for Pricing
View Details