Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUD1 Peptide - C-terminal region

OTUD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DUBA7, OTDC1

UniProt

Q5VV17

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTUD1 Rabbit Polyclonal Antibody (orb587697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138845

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-OATP14 antibody
PAab05953 100 µg

Anti-OATP14 antibody

Sign In for Pricing
View Details
USF2 Antibody Blocking peptide
orb1445056 500 µg

USF2 Antibody Blocking peptide

Sign In for Pricing
View Details
Mouse IgG
AI20004 1 mg

Mouse IgG

Sign In for Pricing
View Details
APOO siRNA (Mouse)
orb1841679-01 15 nmol

APOO siRNA (Mouse)

Sign In for Pricing
View Details
APOO siRNA (Mouse)
orb1841679-02 30 nmol

APOO siRNA (Mouse)

Sign In for Pricing
View Details
ganglioside GM1 Antibody HRP Conjugated
C04058H 100 µL

ganglioside GM1 Antibody HRP Conjugated

Sign In for Pricing
View Details