Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCOA2 Peptide - middle region

NCOA2 Peptide - middle region

Product Specifications

UniProt

Q569J4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCOA2 Rabbit Polyclonal Antibody (orb574377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBL2 Protein, Rat, Recombinant (His)
TMPH-03327-01 5 µg

MBL2 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details
MBL2 Protein, Rat, Recombinant (His)
TMPH-03327-02 10 µg

MBL2 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details
MBL2 Protein, Rat, Recombinant (His)
TMPH-03327-03 20 µg

MBL2 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details
MBL2 Protein, Rat, Recombinant (His)
TMPH-03327-04 50 µg

MBL2 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details
MBL2 Protein, Rat, Recombinant (His)
TMPH-03327-05 100 µg

MBL2 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details
MBL2 Protein, Rat, Recombinant (His)
TMPH-03327-06 200 µg

MBL2 Protein, Rat, Recombinant (His)

Sign In for Pricing
View Details