Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCOA2 Peptide - middle region

NCOA2 Peptide - middle region

Product Specifications

UniProt

Q569J4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NCOA2 Rabbit Polyclonal Antibody (orb574377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC4A1 Recombinant Protein
OPCD01159-200UG 200 µg

SLC4A1 Recombinant Protein

Sign In for Pricing
View Details
NBEAL1 Antibody
A40744-100UG 100 µg

NBEAL1 Antibody

Sign In for Pricing
View Details
Cdk1 sgRNA CRISPR Lentivector set (Mouse)
K4748501 3x 1.0 µg

Cdk1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
ZBTB38 Blocking Peptide
33R-6571 0.1 mg

ZBTB38 Blocking Peptide

Sign In for Pricing
View Details
Striatin-3 (STRN3, Cell Cycle Autoantigen SG2NA GS2NA, S/G2 Antigen, SG2NA) (MaxLight 650)
134017-ML650 100 µL

Striatin-3 (STRN3, Cell Cycle Autoantigen SG2NA GS2NA, S/G2 Antigen, SG2NA) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C1687.08 (SPAC1687.08), partial
MBS7070300 Inquire

Recombinant Schizosaccharomyces pombe Uncharacterized protein C1687.08 (SPAC1687.08), partial

Sign In for Pricing
View Details