Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDZD3 Peptide - C-terminal region

PDZD3 Peptide - C-terminal region

Product Specifications

UniProt

Q86UT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDZD3 Rabbit Polyclonal Antibody (orb587702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APLAEGWALPTKPRCLHLEKGPQGFGFLLREEKGLDGRPGQFLWEVDPGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CLPP Antibody Picoband®
A01117-3 100 µg/Vial

Anti-CLPP Antibody Picoband®

Sign In for Pricing
View Details
Rabbit anti-Drosophila yakuba (Fruit fly) NHP2 Polyclonal Antibody
MBS7198954 Inquire

Rabbit anti-Drosophila yakuba (Fruit fly) NHP2 Polyclonal Antibody

Sign In for Pricing
View Details
GATA4 antibody (Ser105)
70R-33602 0.1 mg

GATA4 antibody (Ser105)

Sign In for Pricing
View Details
MAPKAPK-2(Phospho-Thr334) Rabbit Polyclonal Antibody
JOT-AP11240-01 20 µL

MAPKAPK-2(Phospho-Thr334) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAPKAPK-2(Phospho-Thr334) Rabbit Polyclonal Antibody
JOT-AP11240-02 50 μL

MAPKAPK-2(Phospho-Thr334) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAPKAPK-2(Phospho-Thr334) Rabbit Polyclonal Antibody
JOT-AP11240-03 100 µL

MAPKAPK-2(Phospho-Thr334) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details