Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PREX2 Peptide - N-terminal region

PREX2 Peptide - N-terminal region

Product Specifications

UniProt

Q70Z35

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PREX2 Rabbit Polyclonal Antibody (orb587716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTLL12 Lentiviral Activation Particles (m2)
sc-432393-LAC-2 200 µL

TTLL12 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
SRF (Serum Response Factor) (FITC)
MBS6149884-01 0.1 mL

SRF (Serum Response Factor) (FITC)

Sign In for Pricing
View Details
SRF (Serum Response Factor) (FITC)
MBS6149884-02 5x 0.1 mL

SRF (Serum Response Factor) (FITC)

Sign In for Pricing
View Details
Recombinant Anti-FBXO5 Rabbit mAb
CMA6039-01 30 µL

Recombinant Anti-FBXO5 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-FBXO5 Rabbit mAb
CMA6039-02 50 μL

Recombinant Anti-FBXO5 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-FBXO5 Rabbit mAb
CMA6039-03 100 µL

Recombinant Anti-FBXO5 Rabbit mAb

Sign In for Pricing
View Details