Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE1 Peptide - N-terminal region

SPDYE1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ringo1, SPDYE, WBSCR19

UniProt

Q8NFV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPDYE1 Rabbit Polyclonal Antibody (orb587756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778234

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KREWSDESEEEPEKELAPEPEETWVVETLCGLKMKLKQQRVSPILLEHHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2140652-01 0.1 mL

HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2140652-02 0.2 mL

HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2140652-03 0.5 mL

HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2140652-04 1 mL

HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2140652-05 5 mL

HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)
MBS2140652-06 5x 5 mL

HRP-Linked Monoclonal Antibody to Epidermal Growth Factor Receptor (EGFR)

Sign In for Pricing
View Details