Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE1 Peptide - N-terminal region

SPDYE1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ringo1, SPDYE, WBSCR19

UniProt

Q8NFV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPDYE1 Rabbit Polyclonal Antibody (orb587756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778234

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KREWSDESEEEPEKELAPEPEETWVVETLCGLKMKLKQQRVSPILLEHHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEPDC1B Antibody, Biotin conjugated
A65211-100UG 100 µg

DEPDC1B Antibody, Biotin conjugated

Sign In for Pricing
View Details
SSTR5 Rabbit mAb (AMR12230N)
AMR12230N-01 50 µL

SSTR5 Rabbit mAb (AMR12230N)

Sign In for Pricing
View Details
SSTR5 Rabbit mAb (AMR12230N)
AMR12230N-02 100 µL

SSTR5 Rabbit mAb (AMR12230N)

Sign In for Pricing
View Details
SSTR5 Rabbit mAb (AMR12230N)
AMR12230N-03 200 µL

SSTR5 Rabbit mAb (AMR12230N)

Sign In for Pricing
View Details
GAS41 Antibody
E11-10237C 100 µg

GAS41 Antibody

Sign In for Pricing
View Details
Human Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform (PHKG1) ELISA Kit
GTR10367205 96 Well

Human Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform (PHKG1) ELISA Kit

Sign In for Pricing
View Details