Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBBX Peptide - N-terminal region

ZBBX Peptide - N-terminal region

Product Specifications

UniProt

F2Z370

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZBBX Rabbit Polyclonal Antibody (orb587805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001186131

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKMANSSECEKPKINGKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human P2RY4 Pre-designed siRNA Set B
SI011567B 1 Each

Human P2RY4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SNPH Rabbit Polyclonal Antibody
orb631680-01 50 µg

SNPH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNPH Rabbit Polyclonal Antibody
orb631680-02 100 µg

SNPH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRYGD 3'UTR Luciferase Stable Cell Line
TU005068 1.0 mL

CRYGD 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LHX6 Rabbit Polyclonal Antibody (Fluoro594)
orb3099981 100 µg

LHX6 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
hsa-miR-3162-3p miRNA Mimic
MBS8299437-01 5 nmol

hsa-miR-3162-3p miRNA Mimic

Sign In for Pricing
View Details